PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G184700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 292aa    MW: 31955.2 Da    PI: 6.935
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G184700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM71.81.8e-22121388125
                 NAM   8 hPtdeelvveyLkkkvegkk..leleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratk..sgyWkatgkd 89 
                         hPt+ el++ yL + +++ +   e  e+i+++d+y+++P +L +     ++  +e+ wyfFs+ ++k+ +g+rk r++k  +g W++   +
  Brast01G184700.1.p  12 HPTELELINSYLLPGITSGDtkKESWEFIHHADVYTADPTSLTEmfppaRTIDGEEVWYFFSPVKTKSVHGERKVRTIKsgAGCWHSEAGT 102
                         8**************9998843333457**************744676655557889*******************87733677******* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmhe 125
                         k+v++ +g+ vg ++ + f ++++ + ++t W+m e
  Brast01G184700.1.p 103 KPVCDDRGHRVGHRQFFSFVTKENGRRVRTGWLMVE 138
                         ********************9999999*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100528.3655161IPR003441NAC domain
PfamPF023656.9E-1212138IPR003441NAC domain
SuperFamilySSF1019411.18E-3112161IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MIACPVVLSS RHPTELELIN SYLLPGITSG DTKKESWEFI HHADVYTADP TSLTEMFPPA  60
RTIDGEEVWY FFSPVKTKSV HGERKVRTIK SGAGCWHSEA GTKPVCDDRG HRVGHRQFFS  120
FVTKENGRRV RTGWLMVELG IDNDRQVSRP SELVLCKIYM TPREEITPSK GVIDVVEEHV  180
PSKSSLSPSS PASSTSPPSS PSSYSPPSSS SSPSLPPPTS SLSPSTSPPL PMALLPTLEK  240
LSSSSVMDDK DNGPTILPES TIRLMDTLQQ PYCGRLSRTL YITCINTYFG V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754123.11e-109PREDICTED: NAC domain-containing protein 72-like
TrEMBLA0A0Q3GDB51e-128A0A0Q3GDB5_BRADI; Uncharacterized protein (Fragment)
STRINGSb03g030997.11e-49(Sorghum bicolor)
STRINGSi001850m2e-49(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40112972
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.25e-14NAC family protein